A practical reference on human growth hormone: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-06-16. Anything still debated is marked as such rather than presented as settled.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Peptide fragment | Corresponds to hGH residues 176-191 |
| Common synonyms | AOD9604, hGH 176-191 | Also written as AOD-9604 |
| Typical form | Lyophilized powder | Often supplied in sealed vials |
| Solubility | Water-soluble | Dissolves in aqueous buffers |
| Regulatory status | Not approved as drug | Banned in sport; varies by country |
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
detailed family history conducting a detailed physical examination to document morphological features testing for genetic defect in FGDY1 x-rays can identify skeletal abnormalities echo cardiogram can screen for heart abnormalities CT scan of the brain for cystic development X-ray of the teeth Ultrasound of abdomen to identify undescended testis Similar to all genetic diseases Aarskog–Scott syndrome cannot be cured, although numerous treatments exist to increase the quality of life. Surgery may be required to correct some of the anomalies, and orthodontic treatment may be used to correct some of the facial abnormalities. Trials of growth hormone have been effective to treat short stature in this disorder. Some people may have some mental slowness, but children with this condition often have good social skills. Some males may have problems with fertility. The syndrome is named for Dagfinn Aarskog, a Norwegian pediatrician and human geneticist who first described it in 1970, and for Charles I. Scott, Jr., an American medical geneticist who independently described the syndrome in 1971.
== Tantalum-180m == The nuclide 180mTa (m denotes a metastable state) is one of a very few nuclear isomers which are more stable than their ground states. Although it is not unique in this regard (this property is shared by bismuth-210m (210mBi) and americium-242m (242mAm), among other nuclides), it is exceptional in that it is observationally stable: no decay has ever been observed. In contrast, the ground state nuclide 180Ta has a half-life of only 8 hours. 180mTa has sufficient energy to decay in three ways: isomeric transition to the ground state of 180Ta, beta decay to 180W, or electron capture to 180Hf. However, no radioactivity from any of these theoretically possible decay modes has ever been observed. As of 2023, the half-life of 180mTa is calculated from experimental observation to be at least 2.9×1017 (290 quadrillion) years. The very slow decay of 180mTa is attributed to its high spin (9 units) and the low spin of lower-lying states. Gamma or beta decay would require many units of angular momentum to be removed in a single step, so that the process would be very slow. Similar suppression of gamma or beta decay occurs for 210mBi, a long-lived alpha emitter. Because of this stability, 180mTa is a primordial nuclide, the only naturally occurring nuclear isomer (excluding short-lived radiogenic and cosmogenic nuclides). It presents one of two apparent violations of the Mattauch isobar rule, the other involving tellurium-123. It is also the rarest primordial nuclide in the Universe observed for any element which has any stable isotopes.
Iodine-131 (131I, I-131) is a radioisotope of iodine discovered by Glenn Seaborg and John Livingood in 1938 at the University of California, Berkeley. It has a radioactive decay half-life of about eight days. It is associated with nuclear energy, medical diagnostic and treatment procedures, and natural gas production. It also plays a major role as a radioactive isotope present in nuclear fission products, and was a significant contributor to the health hazards from open-air atomic bomb testing in the 1950s, and from the Chernobyl disaster, as well as being a large fraction of the contamination hazard in the first weeks in the Fukushima nuclear crisis. This is because 131I is a major fission product of uranium and plutonium, comprising nearly 3% of the total products of fission (see fission product yield). Due to its beta decay, iodine-131 causes mutation and death in cells that it penetrates, and other cells up to several millimeters away. For this reason, high doses of the isotope are sometimes less dangerous than low doses, since they tend to kill thyroid tissues that would otherwise become cancerous as a result of the radiation. For example, children treated with moderate dose of 131I for thyroid adenomas had a detectable increase in thyroid cancer, but children treated with a much higher dose did not. Likewise, most studies of very-high-dose 131I for treatment of Graves' disease have failed to find any increase in thyroid cancer, even though there is linear increase in thyroid cancer risk with 131I absorption at moderate doses.
A sphinx ( SFINKS; Ancient Greek: σφίγξ, pronounced [spʰíŋks]; pl. sphinxes or sphinges ) is a mythical creature with the head of a human, the body of a lion, and the wings of an eagle. In Greek tradition, the sphinx is a treacherous and merciless being with the head of a woman, the haunches of a lion, and the wings of a bird. According to Greek myth, she challenges those who encounter her to answer a riddle, and kills and eats them when they fail to solve the riddle. This deadly version of a sphinx appears in the myth and drama of Oedipus. In Egyptian mythology, in contrast, the sphinx is typically depicted as a man (an androsphinx (Ancient Greek: ἀνδρόσφιγξ)), and is seen as a benevolent representation of strength and ferocity, usually of a pharaoh. Unlike Greek or Levantine/Mesopotamian ones, Egyptian sphinxes were not winged. Both the Greek and Egyptian sphinxes were thought of as guardians, and statues of them often flank the entrances to temples. During the Renaissance, the sphinx enjoyed a major revival in European decorative art. During this period, images of the sphinx were initially similar to the ancient Egyptian version, but when later exported to other cultures, the sphinx was often conceived of quite differently, partly due to varied translations of descriptions of the originals, and partly through the evolution of the concept as it was integrated into other cultural traditions. However, depictions of the sphinx are generally associated with grand architectural structures, such as royal tombs or religious temples.
The unit of account of the bitcoin system is the bitcoin. It is most commonly represented with the symbol ₿ designed in 2010 and the currency code BTC. However, the BTC code does not conform to ISO 4217 as BT is the country code of Bhutan, and ISO 4217 requires the first letter used in global commodities to be 'X'. XBT, a code that conforms to ISO 4217 though not officially part of it, is used by Bloomberg L.P. No uniform capitalization convention exists; some sources use Bitcoin, capitalized, to refer to the technology and network, and bitcoin, lowercase, for the unit of account. The Cambridge Advanced Learner's Dictionary and the Oxford Advanced Learner's Dictionary use the capitalized and lowercase variants without distinction. One bitcoin is divisible to eight decimal places. Units for smaller amounts of bitcoin are the millibitcoin (mBTC), equal to 1⁄1000 bitcoin, and the satoshi (sat), representing 1⁄100000000 (one hundred millionth) bitcoin, the smallest amount possible. 100,000 satoshis are one mBTC.
Sources: en.wikipedia.org
With both P-selectin and ICAM-1 on the substrate, cells attached and rolled, but the presence of ICAM-1 had no effect. However, if a neutrophil chemoattractant was added to the flow stream, it activated GPCR signaling, actin polymerization, and integrin-dependent firm adhesion to ICAM-1. Springer integrated these findings into the “three step paradigm” of leukocyte extravasation (diapedesis), which has become the standard framework for understanding leukocyte trafficking in inflammation. The laboratory of Eugene Butcher, including postdoctoral fellow Uli von Andrian, was working on emigration of leukocytes in vivo at the same time, and discovered that antibody to leukocyte integrins inhibited firm adhesion, but not rolling adhesion, to postcapillary venules at sites of inflammation. Butcher and Springer received the 2004 Crafoord Prize for this work. Springer's paradigm that integrins on leukocytes bind to counter-receptors with Ig-like domains on endothelium was later extended by others to integrin α4β1 binding to vascular cell adhesion molecule-1 (VCAM-1), which is inducible by inflammatory mediators on endothelium, and α4β7 binding to mucosal addressin cell adhesion molecule-1 (MAdCAM-1), which is constitutively expressed on mucosal endothelium. At the time that Springer described the three step model, no chemoattractants for peripheral blood lymphocytes that could stimulate emigration were known. Their existence was implied by the ability of pertussis toxin, which modifies the G protein Gαi subunit, to cause lymphocytosis in patients with whooping cough.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Profilin was first described by Lars Carlsson in the lab of Uno Lindberg and co-workers in the early 1970s as the first actin monomer binding protein. It followed the realization that not only muscle, but also non-muscle cells, contained high concentrations of actin, albeit in part in an unpolymerized form. Profilin was then believed to sequester actin monomers (keep them in a pro-filamentous form), and release them upon a signal to make them accessible for fast actin polymer growth.
D-Ribose-L-cysteine was developed by Herbert T. Nagasawa, a medicinal chemist formerly affiliated with the United States Department of Veterans Affairs and the University of Minnesota, whose research focused on sulfur amino acid metabolism and hepatic toxicology. The compound and its use as a glutathione-enhancing agent are protected by multiple patents, including United States Patent US 9,173,917 B2, assigned to Max International and the U.S. Department of Veterans Affairs. D-Ribose-L-cysteine has since been incorporated into dietary supplement formulations marketed by Max International, Inc. and LiveMax, LLC.
RdRps are highly conserved in viruses and are related to telomerase, though the reason for this was an ongoing question as of 2009. The similarity led to speculation that viral RdRps are ancestral to human telomerase. The most famous example of RdRp is in poliovirus. The viral genome is composed of RNA, which enters the cell through receptor-mediated endocytosis. From there, the RNA acts as a template for complementary RNA synthesis. The complementary strand acts as a template for the production of new viral genomes that are packaged and released from the cell ready to infect more host cells. The advantage of this method of replication is that no DNA stage complicates replication. The disadvantage is that no 'back-up' DNA copy is available. Many RdRps associate tightly with membranes making them difficult to study. The best-known RdRps are polioviral 3Dpol, vesicular stomatitis virus L, and hepatitis C virus NS5B protein. Many eukaryotes have RdRps that are involved in RNA interference: these amplify microRNAs and small temporal RNAs and produce double-stranded RNA using small interfering RNAs as primers. These RdRps are used in defense mechanisms and can be appropriated by RNA viruses. Their evolutionary history predates the divergence of major eukaryotic groups.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone, corresponding to amino acids 176-191. It is studied for potential effects on fat metabolism, but it is not approved as a drug in most countries. Its exact mechanism remains under investigation.
No, it is a small fragment of the full growth hormone protein. It does not appear to stimulate growth or increase growth hormone levels in the same way. Its actions are thought to be more limited to metabolic pathways.
Regulatory status varies. It is not approved for medical use in the United States or many other countries. It is banned in sport by WADA, and its sale as a supplement or research chemical may be subject to legal restrictions.
AOD9604 is a synthetic peptide based on a C-terminal segment of human growth hormone. It is manufactured by chemical peptide synthesis rather than extracted from human tissue. The sequence is often described as hGH fragment 176–191 or a close variant.