obesity research comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C | Lyophilized peptide; protect from moisture and light. |
| Typical analytical method | HPLC and mass spectrometry | Used to confirm identity and estimate purity. |
| Common synonyms | AOD9604; hGH 176-191 | Naming varies by supplier and publication. |
| Disulfide bonds | One | Affects folded structure and stability. |
| Typical research purity | ≥95% | Value depends on supplier and analytical method. |
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
== History == Frederick William Hope coined the term myiasis in 1840 to refer to diseases resulting from dipterous larvae as opposed to those caused by other insect larvae (the term for this was scholechiasis). Hope described several cases of myiasis from Jamaica caused by unknown larvae, one of which resulted in death. Even though the term myiasis was first used in 1840, such conditions have been known since ancient times. Ambroise Paré, the chief surgeon to King Charles IX and King Henry III, observed that maggots often infested open wounds.
=== Prevention === Prevention relies on a farm to plate approach involving the whole supply chain anchored in risk analysis and good hygiene practices. Internationally, the Codex Alimentarius General Principles of Food Hygiene provide the foundation for national food safety systems and industry controls. These guidelines are then implemented through various prerequisite programs and HACCP (Hazard Analysis and Critical Control Point) which identify, monitor, and control hazards at specific steps in production. For consumers and food service businesses, evidence-based guidance involves four key steps: Clean, Separate, Cook, Chill. These techniques reduce cross-contamination and ensure lethal heat treatment and rapid refrigeration. Since supply chains are complex, it is critical to prioritize monitoring high-risk foods, such as minimally processed fresh produce, and modifying controls such as, agricultural water safety, manure management, worker hygiene, and post-harvest sanitation. Overall, strengthening surveillance and rapid information-sharing through a One Health lens by linking human, animal, and environmental data, improves outbreak detection and targeted interventions. This is a priority of the WHO Global Strategy for Food Safety 2022–2030.
=== Environmental activism === In 2004, Freeman helped form the Grenada Relief Fund to aid people affected by Hurricane Ivan on the island of Grenada. The fund has since become PLANIT NOW, an organization that seeks to provide preparedness resources for people living in areas affected by hurricanes and severe storms. In 2014, he narrated a clip titled What's Possible which had its debut at the United Nations climate summit. Freeman has donated to the Mississippi Horse Park in Starkville, Mississippi, part of Mississippi State University and Freeman has several horses that he takes there. After learning about the decline of honeybees, Freeman decided to turn his 124-acre ranch into a bee sanctuary in July 2014 beginning with 26 beehives. Freeman is a supporter of Oceana and ocean conservation.
==== Other forms ==== Chitosan can be directly applied to the wound as a hemostatic agent, in granule and powder forms. They are typically salts made from mixing chitosan with an organic acid (such as succinic or lactic acid). One example is Celox granules, US approved 2006. WoundStat (FDA approved, date unknown) is a granule consisting of chitosan within silica (smectite) and polyacrylic acid. It is a combination of different topical hemostatics, mineral and organic.
== Functions == ATP is derived from ribose; it contains one ribose, three phosphate groups, and an adenine base. ATP is created during cellular respiration from adenosine diphosphate (ATP with one less phosphate group).
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
=== Fish === Aquatic animals that swim by using an elongated fin along the dorsum, ventrum, or in pairs on their lateral margins (such as oarfish, knifefish, cephalopods) have all come to the same ratio of amplitude to wavelength of fin undulation to maximize speed, 20:1. Mudskippers and exhibit a number of adaptations to semi-terrestrial lifestyle which are also usually attributed to Devonian tetrapodomorphs such as Tiktaalik: breathing surface air, having eyes positioned on top of the head, propping up and moving on land using strong fins. Pacific leaping blennies also resemble mudskippers though they are not related.
That Awkward Moment (released as Are We Officially Dating? in Australia, Indonesia, and New Zealand) is a 2014 American bromantic comedy drama film written and directed by Tom Gormican in his directorial debut. The film stars Zac Efron, Miles Teller, Michael B. Jordan, Imogen Poots, Mackenzie Davis, and Jessica Lucas. The film had its Los Angeles premiere on January 27, 2014, and it was widely released on January 31 in the United States.
The left heart has two chambers: the left atrium and the left ventricle, separated by the mitral valve. The left atrium receives oxygenated blood back from the lungs via one of the four pulmonary veins. The left atrium has an outpouching called the left atrial appendage. Like the right atrium, the left atrium is lined by pectinate muscles. The left atrium is connected to the left ventricle by the mitral valve. The left ventricle is much thicker as compared with the right, due to the greater force needed to pump blood to the entire body. Like the right ventricle, the left also has trabeculae carneae, but there is no moderator band. The left ventricle pumps blood to the body through the aortic valve and into the aorta. Two small openings above the aortic valve carry blood to the heart muscle; the left coronary artery is above the left cusp of the valve, and the right coronary artery is above the right cusp.
Sources: en.wikipedia.org
No. Major drug regulators have not approved AOD-9604 for weight loss or any other therapeutic indication. It remains an investigational compound studied in research settings.
The World Anti-Doping Agency classifies it as a prohibited peptide hormone. Athletes under anti-doping rules are not permitted to use it. Its presence can trigger a doping violation.
It is a fragment of growth hormone rather than a substance that signals the pituitary to release more hormone. Studies have not shown a consistent rise in IGF-1 or full growth hormone. Its metabolic effects, if any, appear separate from those of the complete hormone.
It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.